Lineage for d6i30a_ (6i30 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014929Species Pseudomonas aeruginosa [TaxId:287] [189201] (31 PDB entries)
  8. 3014975Domain d6i30a_: 6i30 A: [365105]
    automated match to d4hefa_
    complexed with c6s

Details for d6i30a_

PDB Entry: 6i30 (more details), 2.21 Å

PDB Description: crystal structure of the ampc from pseudomonas aeruginosa with 1c
PDB Compounds: (A:) Class C beta-lactamase PDC-301

SCOPe Domain Sequences for d6i30a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i30a_ e.3.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
padrlkalvdaavqpvmkandipglavaislkgephyfsyglaskedgrrvtpetlfeig
svsktftatlagyaltqdkmrlddrasqhwpalqgsrfdgislldlatytagglplqfpd
svqkdqaqirdyyrqwqptyapgsqrlysnpsiglfgylaarslgqpferlmeqqvfpal
gleqthldvpeaalaqyaqgygkddrplrvgpgpldaegygvktsaadllrfvdanlhpe
rldrpwaqaldathrgyykvgdmtqglgweaydwpislkrlqagnstpmalqphriarlp
apqalegqrllnktgstngfgayvafvpgrdlglvilanrnypnaervkiayailsgl

SCOPe Domain Coordinates for d6i30a_:

Click to download the PDB-style file with coordinates for d6i30a_.
(The format of our PDB-style files is described here.)

Timeline for d6i30a_: