Lineage for d6h1oa_ (6h1o A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2331061Protein Cytochrome P450 bm-3 [48268] (2 species)
  7. 2331085Species Bacillus megaterium [TaxId:1404] [48269] (95 PDB entries)
    Uniprot P14779
  8. 3065042Domain d6h1oa_: 6h1o A: [365104]
    automated match to d2uwha_
    complexed with edo, gol, hem, po4, vor

Details for d6h1oa_

PDB Entry: 6h1o (more details), 1.73 Å

PDB Description: structure of the bm3 heme domain in complex with voriconazole
PDB Compounds: (A:) Bifunctional cytochrome P450/NADPH--P450 reductase

SCOPe Domain Sequences for d6h1oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h1oa_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
ikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikea
cdesrfdknlsqalkfvrdffgdglvtswtheknwkkahnillpsfsqqamkgyhammvd
iavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvral
deamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngk
dpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdp
vpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlh
rdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhf
dfedhtnyeldiketltlkpegfvvkakskkiplgg

SCOPe Domain Coordinates for d6h1oa_:

Click to download the PDB-style file with coordinates for d6h1oa_.
(The format of our PDB-style files is described here.)

Timeline for d6h1oa_:

  • d6h1oa_ is new in SCOPe 2.07-stable