Lineage for d1oui__ (1oui -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 28769Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 28802Protein Lysozyme [53961] (13 species)
  7. 28961Species Human (Homo sapiens) [TaxId:9606] [53969] (164 PDB entries)
  8. 29055Domain d1oui__: 1oui - [36510]

Details for d1oui__

PDB Entry: 1oui (more details), 1.8 Å

PDB Description: contribution of hydrophobic residues to the stability of human lysozyme: x-ray structure of the v93a mutant

SCOP Domain Sequences for d1oui__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oui__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadaaacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1oui__:

Click to download the PDB-style file with coordinates for d1oui__.
(The format of our PDB-style files is described here.)

Timeline for d1oui__: