Lineage for d6h8mb_ (6h8m B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3002785Fold d.170: SRCR-like [56486] (2 superfamilies)
    unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta
  4. 3002786Superfamily d.170.1: SRCR-like [56487] (3 families) (S)
  5. 3002798Family d.170.1.0: automated matches [331628] (1 protein)
    not a true family
  6. 3002799Protein automated matches [331629] (4 species)
    not a true protein
  7. 3002812Species Mouse (Mus musculus) [TaxId:10090] [346392] (5 PDB entries)
  8. 3002817Domain d6h8mb_: 6h8m B: [365099]
    automated match to d1by2a_

Details for d6h8mb_

PDB Entry: 6h8m (more details), 1.7 Å

PDB Description: crystal structure of the third srcr domain of murine neurotrypsin.
PDB Compounds: (B:) Neurotrypsin

SCOPe Domain Sequences for d6h8mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h8mb_ d.170.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gfpirlvdgenkkegrvevfvngqwgticddgwtdkhaavicrqlgykgparartmayfg
egkgpihmdnvkctgnekaladcvkqdigrhncrhsedagvicdyle

SCOPe Domain Coordinates for d6h8mb_:

Click to download the PDB-style file with coordinates for d6h8mb_.
(The format of our PDB-style files is described here.)

Timeline for d6h8mb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6h8ma_