Lineage for d6df6d_ (6df6 D:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Estrogen receptor alpha [48519] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48520] (107 PDB entries)
    Uniprot P03372 307-551
  8. Domain d6df6d_: 6df6 D: [365097]
    automated match to d3q95b_
    complexed with g8y, gol

Details for d6df6d_

PDB Entry: 6df6 (more details), 2.5 Å

PDB Description: crystal structure of estrogen receptor alpha in complex with receptor degrader 16ab
PDB Compounds: (D:) Estrogen receptor

SCOPe Domain Sequences for d6df6d_:

Sequence, based on SEQRES records: (download)

>d6df6d_ a.123.1.1 (D:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemld
a

Sequence, based on observed residues (ATOM records): (download)

>d6df6d_ a.123.1.1 (D:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrasmmglltnladrelvhminwakrvpgfvd
ltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmll
atssrfrmmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlma
kagltlqqqhqrlaqlllilshirhmsnkgmehlysmkvpsydlllemlda

SCOPe Domain Coordinates for d6df6d_ are not available.

Timeline for d6df6d_:

Domains from other chains:
(mouse over for more information)
d6df6a_, d6df6b_, d6df6c_