Lineage for d6glla1 (6gll A:1-156)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535539Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2535540Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2535541Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2535542Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species)
  7. 2535543Species Human (Homo sapiens) [TaxId:9606] [103208] (79 PDB entries)
  8. 3065032Domain d6glla1: 6gll A:1-156 [365094]
    Other proteins in same PDB: d6glla2, d6gllb2
    automated match to d1irya_
    protein/DNA complex; complexed with act, bu8, so4

Details for d6glla1

PDB Entry: 6gll (more details), 1.4 Å

PDB Description: crystal structure of hmth1 n33a in complex with lw14 in the presence of acetate
PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d6glla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6glla1 d.113.1.1 (A:1-156) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
mgasrlytlvlvlqpqrvllgmkkrgfgagrwagfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdd
sywfplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d6glla1:

Click to download the PDB-style file with coordinates for d6glla1.
(The format of our PDB-style files is described here.)

Timeline for d6glla1:

  • d6glla1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6glla2