SCOPe 2.08: Domain d6glpa1: 6glp A:1-153

Lineage for d6glpa1 (6glp A:1-153)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103208] (79 PDB entries)

8. Domain d6glpa1: 6glp A:1-153 [365091]
   Other proteins in same PDB: d6glpa2, d6glpb2
   automated match to d1irya_
   protein/DNA complex; complexed with act, bu8, so4
   has additional insertions and/or extensions that are not grouped together

Details for d6glpa1

PDB Entry: 6glp, 1.5 Å

PDB Description: crystal structure of hmth1 n33g in complex with lw14 in the presence of acetate

PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d6glpa1:

Sequence; same for both SEQRES and ATOM records:

>d6glpa1 d.113.1.1 (A:1-153) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
mgasrlytlvlvlqpqrvllgmkkrgfgagrwggfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdd
sywfplllqkkkfhgyfkfqgqdtildytlrev

Timeline for d6glpa1:

• d6glpa1 first appeared in SCOPe 2.07