Lineage for d6h1td_ (6h1t D:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. Protein Cytochrome P450 bm-3 [48268] (2 species)
  7. Species Bacillus megaterium [TaxId:1404] [48269] (95 PDB entries)
    Uniprot P14779
  8. Domain d6h1td_: 6h1t D: [365090]
    automated match to d2uwha_
    complexed with cl6, edo, hem, mpd, mpo, peg, pge

Details for d6h1td_

PDB Entry: 6h1t (more details), 2.08 Å

PDB Description: structure of the bm3 heme domain in complex with clotrimazole
PDB Compounds: (D:) Bifunctional cytochrome P450/NADPH--P450 reductase

SCOPe Domain Sequences for d6h1td_:

Sequence, based on SEQRES records: (download)

>d6h1td_ a.104.1.1 (D:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdffgdglvtswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
fdfedhtnyeldiketltlkpegfvvkakskkiplggi

Sequence, based on observed residues (ATOM records): (download)

>d6h1td_ a.104.1.1 (D:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdffgdglvtswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqraddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkd
petgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpv
psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkiplggi

SCOPe Domain Coordinates for d6h1td_ are not available.

Timeline for d6h1td_:

Domains from other chains:
(mouse over for more information)
d6h1ta_, d6h1tb_, d6h1tc_