Lineage for d6df6b_ (6df6 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2336144Protein automated matches [190059] (14 species)
    not a true protein
  7. 2336166Species Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries)
  8. 3065025Domain d6df6b_: 6df6 B: [365087]
    automated match to d3q95b_
    complexed with g8y, gol

Details for d6df6b_

PDB Entry: 6df6 (more details), 2.5 Å

PDB Description: crystal structure of estrogen receptor alpha in complex with receptor degrader 16ab
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d6df6b_:

Sequence, based on SEQRES records: (download)

>d6df6b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemld
a

Sequence, based on observed residues (ATOM records): (download)

>d6df6b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseypfseasmmglltnladrelvhminwakrvpgfvd
ltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmll
atssrfrmmnlqgeefvclksiillnsgvekdhihrvldkitdtlihlmakagltlqqqh
qrlaqlllilshirhmsnkgmehlysmkpsydlllemlda

SCOPe Domain Coordinates for d6df6b_:

Click to download the PDB-style file with coordinates for d6df6b_.
(The format of our PDB-style files is described here.)

Timeline for d6df6b_:

  • d6df6b_ is new in SCOPe 2.07-stable