Lineage for d6gllb1 (6gll B:1-156)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [103208] (79 PDB entries)
  8. Domain d6gllb1: 6gll B:1-156 [365083]
    Other proteins in same PDB: d6glla2, d6gllb2
    automated match to d1irya_
    protein/DNA complex; complexed with act, bu8, so4

Details for d6gllb1

PDB Entry: 6gll (more details), 1.4 Å

PDB Description: crystal structure of hmth1 n33a in complex with lw14 in the presence of acetate
PDB Compounds: (B:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d6gllb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gllb1 d.113.1.1 (B:1-156) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
mgasrlytlvlvlqpqrvllgmkkrgfgagrwagfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdd
sywfplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d6gllb1 are not available.

Timeline for d6gllb1:

Domains from same chain:
(mouse over for more information)
d6gllb2
Domains from other chains:
(mouse over for more information)
d6glla1, d6glla2