SCOPe 2.08: Domain d6h8ba_: 6h8b A:

Lineage for d6h8ba_ (6h8b A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:354] [194940] (7 PDB entries)

8. Domain d6h8ba_: 6h8b A: [365080]
   automated match to d2ogxa_
   complexed with atp, fuq, j7n, j7q, j7t, j85, j8b, j8e, mg, moo

Details for d6h8ba_

PDB Entry: 6h8b, 1.9 Å

PDB Description: molybdenum storage protein prepared under in vivo-like conditions and incubated with atp and molybdate at 303 k

PDB Compounds: (A:) Molybdenum storage protein subunit alpha

SCOPe Domain Sequences for d6h8ba_:

Sequence; same for both SEQRES and ATOM records:

>d6h8ba_ c.73.1.0 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]}
krpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvg
ldlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsa
fppyhhhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarfl
petsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirt
gvrpa

Timeline for d6h8ba_:

• d6h8ba_ first appeared in SCOPe 2.07