Lineage for d6h8ba_ (6h8b A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. Protein automated matches [190728] (15 species)
    not a true protein
  7. Species Azotobacter vinelandii [TaxId:354] [194940] (7 PDB entries)
  8. Domain d6h8ba_: 6h8b A: [365080]
    automated match to d2ogxa_
    complexed with atp, fuq, j7n, j7q, j7t, j85, j8b, j8e, mg, moo

Details for d6h8ba_

PDB Entry: 6h8b (more details), 1.9 Å

PDB Description: molybdenum storage protein prepared under in vivo-like conditions and incubated with atp and molybdate at 303 k
PDB Compounds: (A:) Molybdenum storage protein subunit alpha

SCOPe Domain Sequences for d6h8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h8ba_ c.73.1.0 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]}
krpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvg
ldlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsa
fppyhhhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarfl
petsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirt
gvrpa

SCOPe Domain Coordinates for d6h8ba_ are not available.

Timeline for d6h8ba_:

Domains from other chains:
(mouse over for more information)
d6h8bb_