Lineage for d6gans_ (6gan S:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624627Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2624628Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2624800Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2624801Protein automated matches [191172] (11 species)
    not a true protein
  7. 2624849Species Escherichia coli [TaxId:83333] [351202] (9 PDB entries)
  8. 2624862Domain d6gans_: 6gan S: [365072]
    Other proteins in same PDB: d6ganl_, d6ganm_
    automated match to d3myrc_
    complexed with f3s, fco, mg, ni, sf4

Details for d6gans_

PDB Entry: 6gan (more details), 1.6 Å

PDB Description: structure of fully reduced hydrogenase (hyd-2) variant e14q
PDB Compounds: (S:) Hydrogenase-2 small chain

SCOPe Domain Sequences for d6gans_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gans_ e.19.1.0 (S:) automated matches {Escherichia coli [TaxId: 83333]}
qrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghqveenkhnal
ekykgqyvlvvdgsiplkdngiycmvagepivdhirkaaegaaaiiaigscsawggvaaa
gvnptgavslqevlpgktvinipgcppnphnflatvahiitygkppklddknrptfaygr
lihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlqfcdvggvwpv
aighpcygcneegigfhkgihqlanve

SCOPe Domain Coordinates for d6gans_:

Click to download the PDB-style file with coordinates for d6gans_.
(The format of our PDB-style files is described here.)

Timeline for d6gans_: