![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
![]() | Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
![]() | Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) ![]() |
![]() | Family e.19.1.0: automated matches [191636] (1 protein) not a true family |
![]() | Protein automated matches [191172] (11 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [351202] (9 PDB entries) |
![]() | Domain d6gant_: 6gan T: [365058] Other proteins in same PDB: d6ganl_, d6ganm_ automated match to d3myrc_ complexed with f3s, fco, mg, ni, sf4 |
PDB Entry: 6gan (more details), 1.6 Å
SCOPe Domain Sequences for d6gant_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gant_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 83333]} qrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghqveenkhnal ekykgqyvlvvdgsiplkdngiycmvagepivdhirkaaegaaaiiaigscsawggvaaa gvnptgavslqevlpgktvinipgcppnphnflatvahiitygkppklddknrptfaygr lihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlqfcdvggvwpv aighpcygcneegigfhkgihqlanve
Timeline for d6gant_: