Lineage for d6gloa1 (6glo A:1-156)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2577869Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2577870Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species)
  7. 2577871Species Human (Homo sapiens) [TaxId:9606] [103208] (79 PDB entries)
  8. 2577939Domain d6gloa1: 6glo A:1-156 [365055]
    Other proteins in same PDB: d6gloa2
    automated match to d1irya_
    complexed with so4

Details for d6gloa1

PDB Entry: 6glo (more details), 1.7 Å

PDB Description: crystal structure of hmth1 n33g in the presence of acetate
PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d6gloa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gloa1 d.113.1.1 (A:1-156) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
mgasrlytlvlvlqpqrvllgmkkrgfgagrwggfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdd
sywfplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d6gloa1:

Click to download the PDB-style file with coordinates for d6gloa1.
(The format of our PDB-style files is described here.)

Timeline for d6gloa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gloa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6glob_