SCOPe 2.08: Domain d6etwa_: 6etw A:

Lineage for d6etwa_ (6etw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.14: Jumonji domain / Histone demethylase core [254153] (7 proteins)
   Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
   Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801; some members include C-terminal helical subdomain (Pfam PF17811)

6. Protein JMJD2D core [254343] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254776] (275 PDB entries)

8. Domain d6etwa_: 6etw A: [365053]
   automated match to d3dxua_
   complexed with bx5, cl, edo, gol, ni, so4, zn

Details for d6etwa_

PDB Entry: 6etw, 1.35 Å

PDB Description: crystal structure of kdm4d with tetrazolhydrazide compound 3

PDB Compounds: (A:) Lysine-specific demethylase 4D

SCOPe Domain Sequences for d6etwa_:

Sequence; same for both SEQRES and ATOM records:

>d6etwa_ b.82.2.14 (A:) JMJD2D core {Human (Homo sapiens) [TaxId: 9606]}
aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
scgearvtfsmdafvrilqperydlwkrgq

Timeline for d6etwa_:

• d6etwa_ first appeared in SCOPe 2.07