Lineage for d134la_ (134l A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2495000Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2495001Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2495039Family d.2.1.2: C-type lysozyme [53960] (3 protein domains)
    automatically mapped to Pfam PF00062
  6. 2495103Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 2495924Species Human (Homo sapiens) [TaxId:9606] [53969] (203 PDB entries)
    Uniprot P00695
  8. 2496060Domain d134la_: 134l A: [36505]
    mutant

Details for d134la_

PDB Entry: 134l (more details), 1.77 Å

PDB Description: role of arg 115 in the catalytic action of human lysozyme. x-ray structure of his 115 and glu 115 mutants
PDB Compounds: (A:) human lysozyme

SCOPe Domain Sequences for d134la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d134la_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnecqnrd
vrqyvqgcgv

SCOPe Domain Coordinates for d134la_:

Click to download the PDB-style file with coordinates for d134la_.
(The format of our PDB-style files is described here.)

Timeline for d134la_: