![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.14: Jumonji domain / Histone demethylase core [254153] (7 proteins) Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801 Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801; some members include C-terminal helical subdomain (Pfam PF17811) |
![]() | Protein JMJD2D core [254343] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [254776] (275 PDB entries) |
![]() | Domain d6etta_: 6ett A: [365048] automated match to d3dxua_ complexed with bxh, cl, edo, na, ni, so4, zn |
PDB Entry: 6ett (more details), 1.26 Å
SCOPe Domain Sequences for d6etta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6etta_ b.82.2.14 (A:) JMJD2D core {Human (Homo sapiens) [TaxId: 9606]} aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc scgearvtfsmdafvrilqperydlwkrg
Timeline for d6etta_: