Lineage for d6ftsa1 (6fts A:3-67)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)
  7. Species Escherichia coli [TaxId:562] [46766] (36 PDB entries)
  8. Domain d6ftsa1: 6fts A:3-67 [365042]
    Other proteins in same PDB: d6ftsa2, d6ftsa3
    automated match to d1a6ia1
    complexed with cl, pg4; mutant

Details for d6ftsa1

PDB Entry: 6fts (more details), 2 Å

PDB Description: tetr(d) n82a mutant in complex with peg4
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d6ftsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ftsa1 a.4.1.9 (A:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys

SCOPe Domain Coordinates for d6ftsa1 are not available.

Timeline for d6ftsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ftsa2, d6ftsa3