Lineage for d6co0c1 (6co0 C:10-236)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2525350Species Piper methysticum [TaxId:130404] [350817] (3 PDB entries)
  8. 2525367Domain d6co0c1: 6co0 C:10-236 [365019]
    automated match to d3wd8a1
    complexed with wca

Details for d6co0c1

PDB Entry: 6co0 (more details), 2.7 Å

PDB Description: crystal structure of piper methysticum styrylpyrone synthase 1 in complex with p-coumaroyl-coa
PDB Compounds: (C:) Styrylpyrone synthase 1

SCOPe Domain Sequences for d6co0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6co0c1 c.95.1.0 (C:10-236) automated matches {Piper methysticum [TaxId: 130404]}
aqrakgpatvlaigtatpanvvyqtdypdyyfrvtksehmtklknkfqrmcdrstikkry
mvlteelleknlslctymepsldarqdilvpevpklgkeaadeaiaewgrpkseithlif
cttcgvdmpgadyqltkllglrssvrrtmlyqqgxfgggtvlrlakdlaennagarvlvv
cseittavnfrgpsdthldllvglalfgdgaaavivgadpdptlerp

SCOPe Domain Coordinates for d6co0c1:

Click to download the PDB-style file with coordinates for d6co0c1.
(The format of our PDB-style files is described here.)

Timeline for d6co0c1:

  • d6co0c1 is new in SCOPe 2.07-stable
  • d6co0c1 does not appear in SCOPe 2.08