Lineage for d6b6ja1 (6b6j A:1-132)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576611Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 2576612Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 2576654Protein automated matches [190412] (11 species)
    not a true protein
  7. 2576661Species Artemisia vulgaris [TaxId:4220] [318111] (2 PDB entries)
  8. 2576663Domain d6b6ja1: 6b6j A:1-132 [365006]
    Other proteins in same PDB: d6b6ja2
    automated match to d5nzba_

Details for d6b6ja1

PDB Entry: 6b6j (more details), 1.9 Å

PDB Description: structure of profilin art v4
PDB Compounds: (A:) Profilin-1

SCOPe Domain Sequences for d6b6ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b6ja1 d.110.1.1 (A:1-132) automated matches {Artemisia vulgaris [TaxId: 4220]}
swqtyvddhlmcdiegtgqhltsaaifgtdgtvwaksasfpefkpneidaiikefneagq
laptglflggakymviqgeagavirgkkgaggicikktgqamvfgiydepvapgqcnmvv
erlgdylldqgm

SCOPe Domain Coordinates for d6b6ja1:

Click to download the PDB-style file with coordinates for d6b6ja1.
(The format of our PDB-style files is described here.)

Timeline for d6b6ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b6ja2