SCOPe 2.08: Domain d6a50b3: 6a50 B:342-527

Lineage for d6a50b3 (6a50 B:342-527)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [254984] (38 PDB entries)

8. Domain d6a50b3: 6a50 B:342-527 [365002]
   Other proteins in same PDB: d6a50a2, d6a50a4, d6a50b2, d6a50b4
   automated match to d1q6za3
   complexed with mg, tpp

Details for d6a50b3

PDB Entry: 6a50, 1.8 Å

PDB Description: structure of benzoylformate decarboxylases in complex with cofactor tpp

PDB Compounds: (B:) benzoylformate decarboxylases

SCOPe Domain Sequences for d6a50b3:

Sequence; same for both SEQRES and ATOM records:

>d6a50b3 c.36.1.0 (B:342-527) automated matches {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygml
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvspv

Timeline for d6a50b3:

• d6a50b3 first appeared in SCOPe 2.07