![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
![]() | Protein automated matches [190561] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries) |
![]() | Domain d6mddb1: 6mdd B:4-110 [364992] Other proteins in same PDB: d6mdda3, d6mddb3 automated match to d2shpa2 complexed with je7, po4 |
PDB Entry: 6mdd (more details), 2.05 Å
SCOPe Domain Sequences for d6mddb1:
Sequence, based on SEQRES records: (download)
>d6mddb1 d.93.1.0 (B:4-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy dlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse
>d6mddb1 d.93.1.0 (B:4-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy dlyggekfatlaelvqyymeqlkvielkyplncadptse
Timeline for d6mddb1: