Lineage for d5z23g_ (5z23 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698057Protein Histone H2A [47115] (7 species)
  7. 2698152Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [419763] (3 PDB entries)
  8. 2698158Domain d5z23g_: 5z23 G: [364984]
    Other proteins in same PDB: d5z23b_, d5z23d_, d5z23f_, d5z23h_
    automated match to d2pyoc_
    protein/DNA complex

Details for d5z23g_

PDB Entry: 5z23 (more details), 2.73 Å

PDB Description: crystal structure of the nucleosome containing a chimeric histone h3/cenp-a catd
PDB Compounds: (G:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d5z23g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z23g_ a.22.1.1 (G:) Histone H2A {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ktrssraglqfpvgrvhrllrkgnyservgagapvymaavleymtaeilelagnaardnk
ktriiprhlqlairndeemnkllgrvtiaqggvlpniqavllpk

SCOPe Domain Coordinates for d5z23g_:

Click to download the PDB-style file with coordinates for d5z23g_.
(The format of our PDB-style files is described here.)

Timeline for d5z23g_: