Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (7 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [419763] (3 PDB entries) |
Domain d5z23g_: 5z23 G: [364984] Other proteins in same PDB: d5z23b_, d5z23d_, d5z23f_, d5z23h_ automated match to d2pyoc_ protein/DNA complex |
PDB Entry: 5z23 (more details), 2.73 Å
SCOPe Domain Sequences for d5z23g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z23g_ a.22.1.1 (G:) Histone H2A {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ktrssraglqfpvgrvhrllrkgnyservgagapvymaavleymtaeilelagnaardnk ktriiprhlqlairndeemnkllgrvtiaqggvlpniqavllpk
Timeline for d5z23g_: