SCOPe 2.08: Domain d6iw2d2: 6iw2 D:296-392

Lineage for d6iw2d2 (6iw2 D:296-392)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Yellow fever virus (strain 17d vaccine) [TaxId:11090] [364873] (3 PDB entries)

8. Domain d6iw2d2: 6iw2 D:296-392 [364983]
   Other proteins in same PDB: d6iw2a1, d6iw2b_, d6iw2c_, d6iw2d1, d6iw2e_, d6iw2f_, d6iw2g1, d6iw2h_, d6iw2i_, d6iw2j1, d6iw2k_, d6iw2l_, d6iw2m1, d6iw2n_, d6iw2o_, d6iw2p1, d6iw2q_, d6iw2r_
   automated match to d3p54a2

Details for d6iw2d2

PDB Entry: 6iw2, 2.9 Å

PDB Description: crystal structure of 5a scfv in complex with yfv-17d se in prefusion state

PDB Compounds: (D:) Envelope protein E

SCOPe Domain Sequences for d6iw2d2:

Sequence; same for both SEQRES and ATOM records:

>d6iw2d2 b.1.18.0 (D:296-392) automated matches {Yellow fever virus (strain 17d vaccine) [TaxId: 11090]}
sykictdkmffvknptdtghgtvvmqvkvskgapcripvivaddltaainkgilvtvnpi
astnddevlievnppfgdsyiivgrgdsrltyqwhke

Timeline for d6iw2d2:

• d6iw2d2 first appeared in SCOPe 2.07