Lineage for d6iw2k_ (6iw2 K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743545Domain d6iw2k_: 6iw2 K: [364977]
    Other proteins in same PDB: d6iw2a1, d6iw2a2, d6iw2d1, d6iw2d2, d6iw2g1, d6iw2g2, d6iw2j1, d6iw2j2, d6iw2m1, d6iw2m2, d6iw2p1, d6iw2p2
    automated match to d2a0ld1

Details for d6iw2k_

PDB Entry: 6iw2 (more details), 2.9 Å

PDB Description: crystal structure of 5a scfv in complex with yfv-17d se in prefusion state
PDB Compounds: (K:) Heavy chain of monoclonal antibody 5A

SCOPe Domain Sequences for d6iw2k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iw2k_ b.1.1.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgprlvkpsetlsltctvsggstynhhwswirqppgrglewigyisysgksnyn
pslksrvtislepsttqfslklnsltaadtavyycareyrddtnyyyysldvwgpgtmvt

SCOPe Domain Coordinates for d6iw2k_:

Click to download the PDB-style file with coordinates for d6iw2k_.
(The format of our PDB-style files is described here.)

Timeline for d6iw2k_: