![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
![]() | Protein automated matches [190252] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187034] (47 PDB entries) |
![]() | Domain d6mdcb3: 6mdc B:219-525 [364974] Other proteins in same PDB: d6mdca1, d6mdca2, d6mdcb1, d6mdcb2 automated match to d2shpa1 complexed with jea, po4 |
PDB Entry: 6mdc (more details), 2.14 Å
SCOPe Domain Sequences for d6mdcb3:
Sequence, based on SEQRES records: (download)
>d6mdcb3 c.45.1.2 (B:219-525) automated matches {Human (Homo sapiens) [TaxId: 9606]} trinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknr yknilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntv ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh csagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymav qhyietl
>d6mdcb3 c.45.1.2 (B:219-525) automated matches {Human (Homo sapiens) [TaxId: 9606]} trinaaeiesrvrelskqgfweefetlqqqeckllysrkegqrqenknknryknilpfdh trvvlhvsdyinaniimpksyiatqgclqntvndfwrmvfqensrvivmttkevergksk cvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhfrtwpdh gvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiirekgvdc didvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl
Timeline for d6mdcb3: