SCOPe 2.06: Domain d1yaqa_: 1yaq A:

Lineage for d1yaqa_ (1yaq A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (203 PDB entries)
   Uniprot P00695

8. Domain d1yaqa_: 1yaq A: [36497]
   complexed with na; mutant

Details for d1yaqa_

PDB Entry: 1yaq, 1.8 Å

PDB Description: contribution of hydrophobic residues to the stability of human lysozyme: calorimetric studies and x-ray structural analysis of the five isoleucine to valine mutants

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1yaqa_:

Sequence; same for both SEQRES and ATOM records:

>d1yaqa_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdnvadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1yaqa_:

• d1yaqa_ first appeared (with stable ids) in SCOP 1.55, called d1yaq__
  
• d1yaqa_ appears in SCOPe 2.05
  
• d1yaqa_ appears in SCOPe 2.07
  
• d1yaqa_ appears in the current release, SCOPe 2.08