Lineage for d6egea_ (6ege A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. Protein automated matches [190417] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1454 PDB entries)
  8. Domain d6egea_: 6ege A: [364948]
    Other proteins in same PDB: d6eged2
    automated match to d4y73c_
    complexed with dl1

Details for d6egea_

PDB Entry: 6ege (more details), 1.4 Å

PDB Description: crystal structure of the unphosphorylated irak4 kinase domain bound to a type i inhibitor
PDB Compounds: (A:) interleukin-1 receptor-associated kinase 4

SCOPe Domain Sequences for d6egea_:

Sequence, based on SEQRES records: (download)

>d6egea_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaamvditte
elkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtppls
whmrckiaqgaanginflhenhhihrniksanilldeaftakisdfglarasekfaqtvm
tsrivgttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldikeeie
deektiedyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemta

Sequence, based on observed residues (ATOM records): (download)

>d6egea_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklalkqqfdqe
ikvmakcqhenlvellgfslclvyvympngslldrlscldgtpplswhmrckiaqgaang
inflhenhhihrniksanilldeaftakisdfglararivgttaymapealrgeitpksd
iysfgvvlleiitglpavdehrepqllldikeeiedeektiedyidkkmndadstsveam
ysvasqclhekknkrpdikkvqqllqemta

SCOPe Domain Coordinates for d6egea_ are not available.

Timeline for d6egea_:

Domains from other chains:
(mouse over for more information)
d6eged1, d6eged2