Lineage for d6iw4a2 (6iw4 A:296-392)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766588Species Yellow fever virus (strain 17d vaccine) [TaxId:11090] [364873] (3 PDB entries)
  8. 2766589Domain d6iw4a2: 6iw4 A:296-392 [364946]
    Other proteins in same PDB: d6iw4a1, d6iw4b1
    automated match to d3p54a2

Details for d6iw4a2

PDB Entry: 6iw4 (more details), 2.8 Å

PDB Description: crystal structure of yfv-17d se in prefusion state
PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d6iw4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iw4a2 b.1.18.0 (A:296-392) automated matches {Yellow fever virus (strain 17d vaccine) [TaxId: 11090]}
sykictdkmffvknptdtghgtvvmqvkvskgapcripvivaddltaainkgilvtvnpi
astnddevlievnppfgdsyiivgrgdsrltyqwhke

SCOPe Domain Coordinates for d6iw4a2:

Click to download the PDB-style file with coordinates for d6iw4a2.
(The format of our PDB-style files is described here.)

Timeline for d6iw4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6iw4a1