SCOPe 2.08: Domain d6iw4a2: 6iw4 A:296-392

Lineage for d6iw4a2 (6iw4 A:296-392)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Yellow fever virus (strain 17d vaccine) [TaxId:11090] [364873] (3 PDB entries)

8. Domain d6iw4a2: 6iw4 A:296-392 [364946]
   Other proteins in same PDB: d6iw4a1, d6iw4b1
   automated match to d3p54a2

Details for d6iw4a2

PDB Entry: 6iw4, 2.8 Å

PDB Description: crystal structure of yfv-17d se in prefusion state

PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d6iw4a2:

Sequence; same for both SEQRES and ATOM records:

>d6iw4a2 b.1.18.0 (A:296-392) automated matches {Yellow fever virus (strain 17d vaccine) [TaxId: 11090]}
sykictdkmffvknptdtghgtvvmqvkvskgapcripvivaddltaainkgilvtvnpi
astnddevlievnppfgdsyiivgrgdsrltyqwhke

Timeline for d6iw4a2:

• d6iw4a2 first appeared in SCOPe 2.07