![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Yellow fever virus (strain 17d vaccine) [TaxId:11090] [364873] (3 PDB entries) |
![]() | Domain d6iw4a2: 6iw4 A:296-392 [364946] Other proteins in same PDB: d6iw4a1, d6iw4b1 automated match to d3p54a2 |
PDB Entry: 6iw4 (more details), 2.8 Å
SCOPe Domain Sequences for d6iw4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iw4a2 b.1.18.0 (A:296-392) automated matches {Yellow fever virus (strain 17d vaccine) [TaxId: 11090]} sykictdkmffvknptdtghgtvvmqvkvskgapcripvivaddltaainkgilvtvnpi astnddevlievnppfgdsyiivgrgdsrltyqwhke
Timeline for d6iw4a2: