![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
![]() | Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) ![]() |
![]() | Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
![]() | Protein automated matches [227047] (11 species) not a true protein |
![]() | Species Yellow fever virus (strain 17d vaccine) [TaxId:11090] [364871] (3 PDB entries) |
![]() | Domain d6iw4a1: 6iw4 A:1-295 [364945] Other proteins in same PDB: d6iw4a2, d6iw4b2 automated match to d3p54a1 |
PDB Entry: 6iw4 (more details), 2.8 Å
SCOPe Domain Sequences for d6iw4a1:
Sequence, based on SEQRES records: (download)
>d6iw4a1 f.10.1.0 (A:1-295) automated matches {Yellow fever virus (strain 17d vaccine) [TaxId: 11090]} ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidrpaevrkvc ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqevefigygkatl ecqvqtavdfgnsyiaemeteswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa tirvlalgnqegslktaltgamrvtkdtndnnlyklhgghvscrvklsaltlkgt
>d6iw4a1 f.10.1.0 (A:1-295) automated matches {Yellow fever virus (strain 17d vaccine) [TaxId: 11090]} ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidrpaevrkvc ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqevefigygkatl ecqvqtavdfgnsyiaemeteswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa tirvlalgnqegslktaltgamrvtkdtlyklhgghvscrvklsaltlkgt
Timeline for d6iw4a1: