SCOPe 2.07: Domain d6np7b_: 6np7 B:

Lineage for d6np7b_ (6np7 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [364274] (2 PDB entries)

8. Domain d6np7b_: 6np7 B: [364923]
   automated match to d5c4qa_

Details for d6np7b_

PDB Entry: 6np7, 2.16 Å

PDB Description: crystal structure of trypanosoma cruzi bromodomain bdf2 (tcclb.506553.20)

PDB Compounds: (B:) Bromodomain factor 2 protein

SCOPe Domain Sequences for d6np7b_:

Sequence; same for both SEQRES and ATOM records:

>d6np7b_ a.29.2.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
gtldkarclafvhqlwdkdklkmfhhpisaaelpdyhkvinypvdlstirqgiesgkyds
dadvqnavaqmianaleynakgtewhqqalsfrsiyldvarqcglsvdddaay

Timeline for d6np7b_:

• d6np7b_ is new in SCOPe 2.07-stable
  
• d6np7b_ appears in the current release, SCOPe 2.08