Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
Protein automated matches [227047] (11 species) not a true protein |
Species Yellow fever virus (strain 17d vaccine) [TaxId:11090] [364871] (3 PDB entries) |
Domain d6iw1c1: 6iw1 C:3-295 [364906] Other proteins in same PDB: d6iw1a2, d6iw1b2, d6iw1c2 automated match to d3p54a1 |
PDB Entry: 6iw1 (more details), 3.1 Å
SCOPe Domain Sequences for d6iw1c1:
Sequence, based on SEQRES records: (download)
>d6iw1c1 f.10.1.0 (C:3-295) automated matches {Yellow fever virus (strain 17d vaccine) [TaxId: 11090]} cigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidrpaevrkvcyn avlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakftca ksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqevefigygkatlec qvqtavdfgnsyiaemeteswivdrqwaqdltlpwqsgsggvwremhhlvefepphaati rvlalgnqegslktaltgamrvtkdtndnnlyklhgghvscrvklsaltlkgt
>d6iw1c1 f.10.1.0 (C:3-295) automated matches {Yellow fever virus (strain 17d vaccine) [TaxId: 11090]} cigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidrpaevrkvcyn avlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakftca ksmslfevdqtkiqyviraqlhdiktlkfdalsgsqevefigygkatlecqvqtavdfgn syiaemeteswivdrqwaqdltlpwqsgsggvwremhhlvefepphaatirvlalgnqeg slktaltgamrvtkdtndnnlyklhgghvscrvklsaltlkgt
Timeline for d6iw1c1:
View in 3D Domains from other chains: (mouse over for more information) d6iw1a1, d6iw1a2, d6iw1b1, d6iw1b2 |