Lineage for d1gb2a_ (1gb2 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 28769Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 28802Protein Lysozyme [53961] (13 species)
  7. 28961Species Human (Homo sapiens) [TaxId:9606] [53969] (164 PDB entries)
  8. Domain d1gb2a_: 1gb2 A: [36490]

Details for d1gb2a_

PDB Entry: 1gb2 (more details), 1.8 Å

PDB Description: crystal structure of mutant human lysozyme substituted at the surface positions

SCOP Domain Sequences for d1gb2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gb2a_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
kmfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1gb2a_ are not available.

Timeline for d1gb2a_: