Lineage for d6ivzh_ (6ivz H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757750Domain d6ivzh_: 6ivz H: [364898]
    Other proteins in same PDB: d6ivza1, d6ivza2, d6ivzl_
    automated match to d4u7sa_

Details for d6ivzh_

PDB Entry: 6ivz (more details), 2.4 Å

PDB Description: crystal structure of 5a scfv complexed with yfv-china se in postfusion state
PDB Compounds: (H:) Heavy chain of monoclonal antibody 5A

SCOPe Domain Sequences for d6ivzh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ivzh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgprlvkpsetlsltctvsggstynhhwswirqppgrglewigyisysgksnyn
pslksrvtislepsttqfslklnsltaadtavyycareyrddtnyyyysldvwgpgtmvt

SCOPe Domain Coordinates for d6ivzh_:

Click to download the PDB-style file with coordinates for d6ivzh_.
(The format of our PDB-style files is described here.)

Timeline for d6ivzh_: