Lineage for d6ec6a1 (6ec6 A:1-185)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. Protein automated matches [190770] (51 species)
    not a true protein
  7. Species Ruminococcus gnavus [TaxId:33038] [361245] (8 PDB entries)
  8. Domain d6ec6a1: 6ec6 A:1-185 [364894]
    Other proteins in same PDB: d6ec6a2, d6ec6a3, d6ec6b2, d6ec6b3
    automated match to d5c70a1
    complexed with cl, gol

Details for d6ec6a1

PDB Entry: 6ec6 (more details), 2.8499999999999996 Å

PDB Description: ruminococcus gnavus beta-glucuronidase
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d6ec6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ec6a1 b.18.1.0 (A:1-185) automated matches {Ruminococcus gnavus [TaxId: 33038]}
mleyselypiqnghrmmqsldgmwkfqfdpeeigeksgwenglpapvsmpvpssfadfft
dhkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvla
distvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwv
ialpe

SCOPe Domain Coordinates for d6ec6a1 are not available.

Timeline for d6ec6a1:

Domains from same chain:
(mouse over for more information)
d6ec6a2, d6ec6a3
Domains from other chains:
(mouse over for more information)
d6ec6b1, d6ec6b2, d6ec6b3