SCOP 1.71: Domain d1yao__: 1yao -

Lineage for d1yao__ (1yao -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (204 PDB entries)

8. Domain d1yao__: 1yao - [36489]
   complexed with na; mutant

Details for d1yao__

PDB Entry: 1yao, 1.8 Å

PDB Description: contribution of hydrophobic residues to the stability of human lysozyme: calorimetric studies and x-ray structural analysis of the five isoleucine to valine mutants

SCOP Domain Sequences for d1yao__:

Sequence; same for both SEQRES and ATOM records:

>d1yao__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygvfqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1yao__:

• d1yao__ first appeared (with stable ids) in SCOP 1.55
  
• d1yao__ appears in SCOP 1.69
  
• d1yao__ is called d1yaoa_ in SCOP 1.73
  
• d1yao__ appears in the current release, SCOPe 2.08, called d1yaoa_