SCOPe 2.08: Domain d6md9b1: 6md9 B:4-110

Lineage for d6md9b1 (6md9 B:4-110)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)

8. Domain d6md9b1: 6md9 B:4-110 [364864]
   Other proteins in same PDB: d6md9a3, d6md9b3
   automated match to d2shpa2
   complexed with jej, po4

Details for d6md9b1

PDB Entry: 6md9, 2.12 Å

PDB Description: non-receptor protein tyrosine phosphatase shp2 in complex with allosteric inhibitor isoxazolo-pyridinone 3

PDB Compounds: (B:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d6md9b1:

Sequence, based on SEQRES records:

>d6md9b1 d.93.1.0 (B:4-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy
dlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse

Sequence, based on observed residues (ATOM records):

>d6md9b1 d.93.1.0 (B:4-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy
dlyggekfatlaelvqyymeqlkielkyplncadptse

Timeline for d6md9b1:

• d6md9b1 first appeared in SCOPe 2.07