SCOPe 2.07: Domain d6ivza2: 6ivz A:296-392

Lineage for d6ivza2 (6ivz A:296-392)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Yellow fever virus [TaxId:11089] [255299] (4 PDB entries)

8. Domain d6ivza2: 6ivz A:296-392 [364858]
   Other proteins in same PDB: d6ivza1, d6ivzh_, d6ivzl_
   automated match to d3p54a2

Details for d6ivza2

PDB Entry: 6ivz, 2.4 Å

PDB Description: crystal structure of 5a scfv complexed with yfv-china se in postfusion state

PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d6ivza2:

Sequence; same for both SEQRES and ATOM records:

>d6ivza2 b.1.18.0 (A:296-392) automated matches {Yellow fever virus [TaxId: 11089]}
sykmctdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaavnkgilvtvnpi
astnddevlievnppfgdsyiivgtgdsrltyqwhke

Timeline for d6ivza2:

• d6ivza2 is new in SCOPe 2.07-stable
  
• d6ivza2 appears in the current release, SCOPe 2.08