Lineage for d6ivza2 (6ivz A:296-392)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766600Species Yellow fever virus [TaxId:11089] [255299] (4 PDB entries)
  8. 2766603Domain d6ivza2: 6ivz A:296-392 [364858]
    Other proteins in same PDB: d6ivza1, d6ivzh_, d6ivzl_
    automated match to d3p54a2

Details for d6ivza2

PDB Entry: 6ivz (more details), 2.4 Å

PDB Description: crystal structure of 5a scfv complexed with yfv-china se in postfusion state
PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d6ivza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ivza2 b.1.18.0 (A:296-392) automated matches {Yellow fever virus [TaxId: 11089]}
sykmctdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaavnkgilvtvnpi
astnddevlievnppfgdsyiivgtgdsrltyqwhke

SCOPe Domain Coordinates for d6ivza2:

Click to download the PDB-style file with coordinates for d6ivza2.
(The format of our PDB-style files is described here.)

Timeline for d6ivza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ivza1