SCOPe 2.08: Domain d6ivza1: 6ivz A:2-295

Lineage for d6ivza1 (6ivz A:2-295)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families)

5. Family f.10.1.0: automated matches [227258] (1 protein)
   not a true family

6. Protein automated matches [227047] (11 species)
   not a true protein

7. Species Yellow fever virus [TaxId:11089] [359531] (3 PDB entries)

8. Domain d6ivza1: 6ivz A:2-295 [364857]
   Other proteins in same PDB: d6ivza2, d6ivzh_, d6ivzl_
   automated match to d3p54a1

Details for d6ivza1

PDB Entry: 6ivz, 2.4 Å

PDB Description: crystal structure of 5a scfv complexed with yfv-china se in postfusion state

PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d6ivza1:

Sequence; same for both SEQRES and ATOM records:

>d6ivza1 f.10.1.0 (A:2-295) automated matches {Yellow fever virus [TaxId: 11089]}
hcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldislqtvaidgpaearkvcy
savlthvkindkcpstgeahlaeendgdnackrtysdrgwgngcglfgkgsivacakftc
aksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatle
cqvqtavdfgnsyiaemekdswivdrqwaqdltlpwqsgsggiwremhhlvefepphaat
irvlalgnqegslktaltgamrvtkdendnnlyklhgghvscrvklsaltlkgt

Timeline for d6ivza1:

• d6ivza1 first appeared in SCOPe 2.07