![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
![]() | Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) ![]() |
![]() | Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
![]() | Protein automated matches [227047] (11 species) not a true protein |
![]() | Species Yellow fever virus [TaxId:11089] [359531] (3 PDB entries) |
![]() | Domain d6ivza1: 6ivz A:2-295 [364857] Other proteins in same PDB: d6ivza2, d6ivzh_, d6ivzl_ automated match to d3p54a1 |
PDB Entry: 6ivz (more details), 2.4 Å
SCOPe Domain Sequences for d6ivza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ivza1 f.10.1.0 (A:2-295) automated matches {Yellow fever virus [TaxId: 11089]} hcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldislqtvaidgpaearkvcy savlthvkindkcpstgeahlaeendgdnackrtysdrgwgngcglfgkgsivacakftc aksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatle cqvqtavdfgnsyiaemekdswivdrqwaqdltlpwqsgsggiwremhhlvefepphaat irvlalgnqegslktaltgamrvtkdendnnlyklhgghvscrvklsaltlkgt
Timeline for d6ivza1: