Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d6iw2e_: 6iw2 E: [364852] Other proteins in same PDB: d6iw2a1, d6iw2a2, d6iw2d1, d6iw2d2, d6iw2g1, d6iw2g2, d6iw2j1, d6iw2j2, d6iw2m1, d6iw2m2, d6iw2p1, d6iw2p2 automated match to d2a0ld1 |
PDB Entry: 6iw2 (more details), 2.9 Å
SCOPe Domain Sequences for d6iw2e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iw2e_ b.1.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesgprlvkpsetlsltctvsggstynhhwswirqppgrglewigyisysgksnyn pslksrvtislepsttqfslklnsltaadtavyycareyrddtnyyyysldvwgpgtmvt
Timeline for d6iw2e_: