Lineage for d6hcnb_ (6hcn B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386499Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2386500Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2386501Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2386502Protein Adenovirus fiber protein "knob" domain [49837] (18 species)
  7. 2386567Species Human adenovirus 5 [TaxId:28285] [364849] (1 PDB entry)
  8. 2386568Domain d6hcnb_: 6hcn B: [364850]
    automated match to d1qhva_
    complexed with edo, mg

Details for d6hcnb_

PDB Entry: 6hcn (more details), 1.49 Å

PDB Description: adenovirus type 5 fiber knob protein at 1.49a resolution
PDB Compounds: (B:) fiber protein

SCOPe Domain Sequences for d6hcnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hcnb_ b.21.1.1 (B:) Adenovirus fiber protein "knob" domain {Human adenovirus 5 [TaxId: 28285]}
knndkltlwttpapspncrlnaekdakltlvltkcgsqilatvsvlavkgslapisgtvq
sahliirfdengvllnnsfldpeywnfrngdltegtaytnavgfmpnlsaypkshgktak
snivsqvylngdktkpvtltitlngtqetgdttpsaysmsfswdwsghnyineifatssy
tfsyiaqe

SCOPe Domain Coordinates for d6hcnb_:

Click to download the PDB-style file with coordinates for d6hcnb_.
(The format of our PDB-style files is described here.)

Timeline for d6hcnb_: