Lineage for d6ecab3 (6eca B:279-602)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (125 species)
    not a true protein
  7. 3064741Species Lactobacillus rhamnosus [TaxId:47715] [364803] (1 PDB entry)
  8. 3064786Domain d6ecab3: 6eca B:279-602 [364848]
    Other proteins in same PDB: d6ecaa1, d6ecaa2, d6ecab1, d6ecab2
    automated match to d5c70a3
    complexed with cl, gol

Details for d6ecab3

PDB Entry: 6eca (more details), 2.85 Å

PDB Description: lactobacillus rhamnosus beta-glucuronidase
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d6ecab3:

Sequence, based on SEQRES records: (download)

>d6ecab3 c.1.8.0 (B:279-602) automated matches {Lactobacillus rhamnosus [TaxId: 47715]}
ikisgtdilvndkpiylkgfgrhedspfagrafdlnvekkdfalmkwigansfrtshypy
deqvykiadeegflltdevpavgfkmaaaaflgglnqsffkgpwlkklherhidqirdli
krdknhpsvlawslfnepdtidenavpyfkqifdeskdldpqgrprtftlseddtietsk
vldfpdfymlnrypgwyhfggyqisdgeaglrdemdkwqkagvkkpvvftefgadteagl
hklpsvmwteeyqvevlkmfsrvfddydfikgeqvwnladfqtvegnmrvngnkkgiftr
drqpkaaaffyhdrwnklpldyka

Sequence, based on observed residues (ATOM records): (download)

>d6ecab3 c.1.8.0 (B:279-602) automated matches {Lactobacillus rhamnosus [TaxId: 47715]}
ikisgtdilvndkpiylkgfgrhedspfagrafdlnvekkdfalmkwigansfrtshypy
deqvykiadeegflltdevpavgfkmasffkgpwlkklherhidqirdlikrdknhpsvl
awslfnepdtidenavpyfkqifdeskdldpqgrprtftlseddtietskvldfpdfyml
nrypgwyhfggyqisdgeaglrdemdkwqkagvkkpvvftefgadteaglhklpsvmwte
eyqvevlkmfsrvfddydfikgeqvwnladfqtvegnmrvngnkkgiftrdrqpkaaaff
yhdrwnklpldyka

SCOPe Domain Coordinates for d6ecab3:

Click to download the PDB-style file with coordinates for d6ecab3.
(The format of our PDB-style files is described here.)

Timeline for d6ecab3:

  • d6ecab3 is new in SCOPe 2.07-stable