Lineage for d6ecab1 (6eca B:1-184)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. Protein automated matches [190770] (51 species)
    not a true protein
  7. Species Lactobacillus rhamnosus [TaxId:47715] [364799] (1 PDB entry)
  8. Domain d6ecab1: 6eca B:1-184 [364846]
    Other proteins in same PDB: d6ecaa2, d6ecaa3, d6ecab2, d6ecab3
    automated match to d5c70a1
    complexed with cl, gol

Details for d6ecab1

PDB Entry: 6eca (more details), 2.8499999999999996 Å

PDB Description: lactobacillus rhamnosus beta-glucuronidase
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d6ecab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ecab1 b.18.1.0 (B:1-184) automated matches {Lactobacillus rhamnosus [TaxId: 47715]}
metsllypvtndqrtdqkldglwqfkfdeagegeksgwetgfhdgvsmpvpasfndfftd
kasreytgdfwysrnffvpsaakgkalflrfdavthratifvngkeirtheggflpfaad
iseavkygaentvvvkgnnelsrealpagdtitlrngkkmvrpffdfynysglnrsvhll
slpq

SCOPe Domain Coordinates for d6ecab1 are not available.

Timeline for d6ecab1:

Domains from same chain:
(mouse over for more information)
d6ecab2, d6ecab3
Domains from other chains:
(mouse over for more information)
d6ecaa1, d6ecaa2, d6ecaa3