Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein Lysozyme [53961] (15 species) ubiquitous in a variety of tissues and secretions |
Species Human (Homo sapiens) [TaxId:9606] [53969] (204 PDB entries) Uniprot P00695 |
Domain d1gfka_: 1gfk A: [36484] complexed with na; mutant |
PDB Entry: 1gfk (more details), 1.8 Å
SCOPe Domain Sequences for d1gfka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gfka_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]} kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin srywcndgktpgannachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd vrqyvqgcgv
Timeline for d1gfka_: