Lineage for d6ce1a3 (6ce1 A:294-664)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537906Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2537907Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2538050Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 2538051Protein automated matches [190175] (10 species)
    not a true protein
  7. 2538071Species Human (Homo sapiens) [TaxId:9606] [187904] (35 PDB entries)
  8. 3064773Domain d6ce1a3: 6ce1 A:294-664 [364835]
    Other proteins in same PDB: d6ce1a1, d6ce1a2
    automated match to d3b1ua3

Details for d6ce1a3

PDB Entry: 6ce1 (more details), 2.8 Å

PDB Description: crystal structure of peptidyl arginine deiminase type iii (padi3)
PDB Compounds: (A:) Protein-arginine deiminase type-3

SCOPe Domain Sequences for d6ce1a3:

Sequence, based on SEQRES records: (download)

>d6ce1a3 d.126.1.0 (A:294-664) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apwimtpstlpplevyvcrvrnntcfvdavaelarkagcklticpqaenrndrwiqdeme
lgyvqaphktlpvvfdsprngelqdfpykrilgpdfgyvtreprdrsvsgldsfgnlevs
ppvvangkeyplgriliggnlpgssgrrvtqvvrdflhaqkvqppvelfvdwlavghvde
flsfvpapdgkgfrmllaspgacfklfqekqkcghgrallfqgvvddeqvktisinqvls
nkdlinynkfvqscidwnrevlkrelglaecdiidipqlfkterkkataffpdlvnmlvl
gkhlgipkpfgpiingcccleekvrslleplglhctfiddftpyhmlhgevhcgtnvcrk
pfsfkwwnmvp

Sequence, based on observed residues (ATOM records): (download)

>d6ce1a3 d.126.1.0 (A:294-664) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apwimtpstlpplevyvcrvrnntcfvdavaelarkagcklticiqdemelgyvqaphkt
lpvvfdsrilgpdfgyvtrepsfgnlevsppvvangkeyplgriliggnlpgssgrrvtq
vvrdflhaqkvqppvelfvdwlavghvdeflsfvpapdgkgfrmllaspgacfklfqekq
kcghgrallfqgvvddeqvktisinqvlsnkdlinynkfvqscidwnrevlkrelglaec
diidipqlfkterkkataffpdlvnmlvlgkhlgipkpfgpiingcccleekvrsllepl
glhctfiddftpycgtnvcrkpfsfkwwnmvp

SCOPe Domain Coordinates for d6ce1a3:

Click to download the PDB-style file with coordinates for d6ce1a3.
(The format of our PDB-style files is described here.)

Timeline for d6ce1a3:

  • d6ce1a3 is new in SCOPe 2.07-stable