Lineage for d6ce1a2 (6ce1 A:115-293)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families) (S)
    automatically mapped to Pfam PF08527
  5. Family b.2.9.0: automated matches [272207] (1 protein)
    not a true family
  6. Protein automated matches [272208] (1 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [272209] (26 PDB entries)
  8. Domain d6ce1a2: 6ce1 A:115-293 [364834]
    Other proteins in same PDB: d6ce1a1, d6ce1a3
    automated match to d2dexx1

Details for d6ce1a2

PDB Entry: 6ce1 (more details), 2.8 Å

PDB Description: crystal structure of peptidyl arginine deiminase type iii (padi3)
PDB Compounds: (A:) Protein-arginine deiminase type-3

SCOPe Domain Sequences for d6ce1a2:

Sequence, based on SEQRES records: (download)

>d6ce1a2 b.2.9.0 (A:115-293) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdisldcdlncegrqdrnfvdkrqwvwgpsgyggillvncdrddpscdvqdncdqhvhcl
qdledmsvmvlrtqgpaalfddhklvlhtssydakraqvfhicgpedvceayrhvlgqdk
vsyevprlhgdeerffveglsfpdagftglisfhvtllddsnedfsaspiftdtvvfrv

Sequence, based on observed residues (ATOM records): (download)

>d6ce1a2 b.2.9.0 (A:115-293) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdisldcdlncegrqdkrqwvwgpsgyggillvncdqdledmsvmvlrtqgpaalfddhk
lvlhtssydakraqvfhiceayrhvlgqdkvsyevprlhgdeerffveglsfpdagftgl
isfhvtllddsnedfsaspiftdtvvfrv

SCOPe Domain Coordinates for d6ce1a2 are not available.

Timeline for d6ce1a2:

Domains from same chain:
(mouse over for more information)
d6ce1a1, d6ce1a3