Lineage for d6ce1a1 (6ce1 A:2-114)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772475Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries)
  8. 2772522Domain d6ce1a1: 6ce1 A:2-114 [364833]
    Other proteins in same PDB: d6ce1a2, d6ce1a3
    automated match to d2dexx2

Details for d6ce1a1

PDB Entry: 6ce1 (more details), 2.8 Å

PDB Description: crystal structure of peptidyl arginine deiminase type iii (padi3)
PDB Compounds: (A:) Protein-arginine deiminase type-3

SCOPe Domain Sequences for d6ce1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ce1a1 b.6.1.0 (A:2-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slqrivrvslehptsavcvagvetlvdiygsvpegtemfevygtpgvdiyispnmergre
radtrrwrfdatleiivvmnspsndlndshvqisyhssheplplayavlyltc

SCOPe Domain Coordinates for d6ce1a1:

Click to download the PDB-style file with coordinates for d6ce1a1.
(The format of our PDB-style files is described here.)

Timeline for d6ce1a1: