Lineage for d6e6mc1 (6e6m C:2-134)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. Protein automated matches [190295] (6 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187133] (89 PDB entries)
  8. Domain d6e6mc1: 6e6m C:2-134 [364825]
    Other proteins in same PDB: d6e6ma2, d6e6mb2, d6e6mc2
    automated match to d5ljha_
    complexed with 8cb

Details for d6e6mc1

PDB Entry: 6e6m (more details), 1.55 Å

PDB Description: crystal structure of human cellular retinol-binding protein 1 in complex with cannabidiorcin (cbdo)
PDB Compounds: (C:) Retinol-binding protein 1

SCOPe Domain Sequences for d6e6mc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e6mc1 b.60.1.2 (C:2-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdftgywkmlvnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrnyi
mdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemrv
egvvckqvfkkvq

SCOPe Domain Coordinates for d6e6mc1 are not available.

Timeline for d6e6mc1:

Domains from same chain:
(mouse over for more information)
d6e6mc2
Domains from other chains:
(mouse over for more information)
d6e6ma1, d6e6ma2, d6e6mb1, d6e6mb2