Lineage for d6ed2a2 (6ed2 A:188-279)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763233Species Faecalibacterium prausnitzii [TaxId:411483] [364811] (1 PDB entry)
  8. 2763234Domain d6ed2a2: 6ed2 A:188-279 [364812]
    Other proteins in same PDB: d6ed2a1, d6ed2a3, d6ed2a4
    automated match to d5c71a2
    complexed with fmt, gol, mg

Details for d6ed2a2

PDB Entry: 6ed2 (more details), 2.3 Å

PDB Description: faecalibacterium prausnitzii beta-glucuronidase
PDB Compounds: (A:) Glycosyl hydrolase family 2, TIM barrel domain protein

SCOPe Domain Sequences for d6ed2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ed2a2 b.1.4.0 (A:188-279) automated matches {Faecalibacterium prausnitzii [TaxId: 411483]}
ervldystryrltetgaeidytvstngphpvtvelydgttrvaessgttgtlvvknarlw
nvhaaylydlvirihegsavvdeyldrigirt

SCOPe Domain Coordinates for d6ed2a2:

Click to download the PDB-style file with coordinates for d6ed2a2.
(The format of our PDB-style files is described here.)

Timeline for d6ed2a2: